Skip to main content
RUO Limitless Life Nootropics — free shipping on orders over $200 · Same-day USA dispatch.
Home Shop A-Z
Shop by Research Category
Shop by Type
Cart Checkout FAQs Contact Us Blog Call (813) 203-3466

LL-37 (Cathelicidin) Peptide

$79.00

For Research Use Only. Not for human use. Research-grade LL-37 (Cathelicidin, CAP-18) is the human 37-amino-acid antimicrobial peptide ([LL-37, 37 aa]), intended for controlled in vitro investigations of innate immunity mechanisms, microbial membrane disruption, inflammatory signaling modulation, and epithelial defense pathways in laboratory settings.

Discount per Quantity

Quantity 5 – 9 10 +
Discount 5% 10%
Price $75.05 $71.10

Orders over $200: FREE USPS Priority shipping.

  • >99% purity — HPLC + MS verified
  • Cold-pack insulated mailers
  • Discreet US shipping (2–5 days)
  • COA available on request

Research Use Only. Not for human consumption. Sold strictly for laboratory and research use.

LL-37 (Cathelicidin) Peptide is a lyophilized research peptide synthesized in the United States, lyophilized in sterile vials, and verified by HPLC and mass spectrometry to greater than 99% purity. Sold strictly for laboratory and research use.

Overview

LL-37 (Cathelicidin) Peptide is supplied as a lyophilized powder ready for reconstitution with bacteriostatic water. Each vial ships with a documented Certificate of Analysis available on request, including HPLC chromatograms and mass spectrometry confirmation of identity. Material is intended for in-vitro and in-vivo research workflows where compound purity and identity must be tightly controlled.

Specifications

  • Form: Lyophilized powder
  • Purity: >99% (HPLC verified)
  • Identity: Confirmed by ESI mass spectrometry
  • Origin: Synthesized and lyophilized in the USA
  • Packaging: Sealed glass vial, lot-coded, COA available

Reconstitution

Reconstitute with bacteriostatic water (0.9% benzyl alcohol) for short-term laboratory storage. Direct the diluent down the side of the vial rather than onto the lyophilized cake, then swirl gently until fully dissolved. Do not shake vigorously. Volume should be selected to produce the working concentration required by the protocol — see our reconstitution guide for worked examples.

Storage

Store the lyophilized vial at −20°C, desiccated and protected from light. After reconstitution, store at 2–8°C and use within 14–30 days, depending on stability data for the specific sequence. Aliquot at the time of reconstitution to avoid repeated freeze-thaw cycles.

Research Notes

LL-37 (Cathelicidin) Peptide has been the subject of multiple peer-reviewed investigations. Researchers should consult primary literature (PubMed, Google Scholar) before designing experiments and confirm dose-ranges, vehicle compatibility, and analytical methods against the published methodology. The accompanying COA should be filed with experimental records to support reproducibility.

Quality Assurance

Every lot is tested in-line for identity and purity. Lyophilization, capping, and labeling occur in a controlled environment, and lot-specific COAs link directly to the chromatograms produced during release testing. Any anomaly during release halts shipment until investigation is complete.

Disclaimer

Research Use Only. LL-37 (Cathelicidin) Peptide is sold exclusively for laboratory and research applications. It is not a drug, supplement, food, cosmetic, or medical device, and is not intended for human or veterinary use. By purchasing, the buyer affirms they are a qualified researcher and accepts full responsibility for safe handling, storage, and disposal in accordance with applicable laws and institutional policies.

Frequently bought together

Reviews

There are no reviews yet.

Be the first to review “LL-37 (Cathelicidin) Peptide”

Your email address will not be published. Required fields are marked *