LL-37 (Cathelicidin) Peptide

For Research Use Only. Not for human use.

LL-37 is the only human cathelicidin antimicrobial peptide, cleaved from the C-terminal of the hCAP-18 precursor protein in neutrophils, macrophages, and epithelial cells. This α-helical, cationic peptide is of significant scientific interest for its broad-spectrum activity against bacteria, viruses, fungi, and biofilms, as well as its role in modulating innate immune responses, including chemotaxis and cytokine regulation. Discovered in the 1990s, it is a cornerstone of laboratory research on innate defense mechanisms and inflammatory pathways. This research-grade lyophilized powder is synthesized under strict quality controls and provided with full analytical documentation. For in vitro and laboratory research purposes only.

Key Scientific Attributes

• High-purity LL-37 (≥99% by HPLC/MS, acetate salt form)
• Verified 37-amino-acid sequence: [LL-37, 37 aa]
• Lyophilized formulation for maximum long-term stability
• Full Certificate of Analysis (COA) with HPLC, MS, and amino acid analysis
• Manufactured in GMP-aligned, ISO-compliant facilities
• Suitable for innate immunity, biofilm disruption, and epithelial barrier laboratory studies

Research-Referenced Attributes (Based on published scientific literature; provided for laboratory research context only. Not intended as health, therapeutic, or clinical claims.)

• Broad antimicrobial spectrum in vitro: studied for disruption of gram-positive and gram-negative bacterial membranes and biofilm models (ncbi.nlm.nih.gov)
• Investigated the epithelial barrier and re-epithelializationin  cell-based assay models
• Studied for modulation of inflammatory signaling pathways, including chemotaxis and cytokine expression in laboratory settings (pmc.ncbi.nlm.nih.gov)
• Used in autoimmune disease in vitro research models
• Investigated for antiviral activity against enveloped viruses and membrane-targeting mechanisms in laboratory studies (mdpi.com)
• Relevant to infection, inflammation, and autoimmune in vitro research applications

Why Researchers Choose This LL-37

• Exact human cathelicidin sequence used in landmark published antimicrobial studies (sciencedirect.com)
• Transparent analytical data (HPLC ≥99%, MS confirmation)
• Suitable for immunology, microbiology, and epithelial biology laboratory applications
• Competitive research pricing with bulk options available