LL-37 (Cathelicidin) Peptide
$79.00
For Research Use Only. Not for human use. Research-grade LL-37 (Cathelicidin, CAP-18) is the human 37-amino-acid antimicrobial peptide ([LL-37, 37 aa]), intended for controlled in vitro investigations of innate immunity mechanisms, microbial membrane disruption, inflammatory signaling modulation, and epithelial defense pathways in laboratory settings.
Discount per Quantity
| Quantity | 5 – 9 | 10 + |
|---|---|---|
| Discount | 5% | 10% |
| Price | $75.05 | $71.10 |
Orders over $200: FREE USPS Priority shipping.
- >99% purity — HPLC + MS verified
- Cold-pack insulated mailers
- Discreet US shipping (2–5 days)
- COA available on request
Research Use Only. Not for human consumption. Sold strictly for laboratory and research use.
LL-37 (Cathelicidin) Peptide is a lyophilized research peptide synthesized in the United States, lyophilized in sterile vials, and verified by HPLC and mass spectrometry to greater than 99% purity. Sold strictly for laboratory and research use.
Overview
LL-37 (Cathelicidin) Peptide is supplied as a lyophilized powder ready for reconstitution with bacteriostatic water. Each vial ships with a documented Certificate of Analysis available on request, including HPLC chromatograms and mass spectrometry confirmation of identity. Material is intended for in-vitro and in-vivo research workflows where compound purity and identity must be tightly controlled.
Specifications
- Form: Lyophilized powder
- Purity: >99% (HPLC verified)
- Identity: Confirmed by ESI mass spectrometry
- Origin: Synthesized and lyophilized in the USA
- Packaging: Sealed glass vial, lot-coded, COA available
Reconstitution
Reconstitute with bacteriostatic water (0.9% benzyl alcohol) for short-term laboratory storage. Direct the diluent down the side of the vial rather than onto the lyophilized cake, then swirl gently until fully dissolved. Do not shake vigorously. Volume should be selected to produce the working concentration required by the protocol — see our reconstitution guide for worked examples.
Storage
Store the lyophilized vial at −20°C, desiccated and protected from light. After reconstitution, store at 2–8°C and use within 14–30 days, depending on stability data for the specific sequence. Aliquot at the time of reconstitution to avoid repeated freeze-thaw cycles.
Research Notes
LL-37 (Cathelicidin) Peptide has been the subject of multiple peer-reviewed investigations. Researchers should consult primary literature (PubMed, Google Scholar) before designing experiments and confirm dose-ranges, vehicle compatibility, and analytical methods against the published methodology. The accompanying COA should be filed with experimental records to support reproducibility.
Quality Assurance
Every lot is tested in-line for identity and purity. Lyophilization, capping, and labeling occur in a controlled environment, and lot-specific COAs link directly to the chromatograms produced during release testing. Any anomaly during release halts shipment until investigation is complete.
Disclaimer
Research Use Only. LL-37 (Cathelicidin) Peptide is sold exclusively for laboratory and research applications. It is not a drug, supplement, food, cosmetic, or medical device, and is not intended for human or veterinary use. By purchasing, the buyer affirms they are a qualified researcher and accepts full responsibility for safe handling, storage, and disposal in accordance with applicable laws and institutional policies.
| SKU | ll-37-5mg |
|---|---|
| Category | Peptides |
| Purity | >99% (HPLC + MS verified) |
| Form | Lyophilized powder |
| Origin | Synthesized in the USA |
Certificate of Analysis
Every lot is verified by reverse-phase HPLC for purity and by mass spectrometry for identity. A current COA is available on request — email sales@limitlesslifenootropics.st with the lot number printed on your vial.
- HPLC purity: >99%
- Identity confirmed by ESI-MS
- Lyophilized, sterile-filtered solutions where applicable
- Stored at −20°C until shipment
Shipping & handling
Orders placed before 2pm CT ship the same business day in cold-pack insulated mailers. USPS Priority delivery in 2–5 business days. Free shipping on US orders over $200.
Frequently asked questions
How should I reconstitute this peptide?
Use bacteriostatic water for short-term lab storage. Direct the diluent down the side of the vial, swirl gently — do not shake.
What is the shelf life?
Lyophilized peptide stored at −20°C is stable for 24+ months. Reconstituted peptide should be refrigerated and used within 2–4 weeks.
Do you ship internationally?
We currently ship within the United States only. International researchers should contact our bulk team for institutional quotes.
Frequently bought together



Reviews
There are no reviews yet.